pTH (1-31) (human),CAS:157938-23-3
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-OH
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1144 | 0.5mg | 615.00 | + Add to cart |
|
R-M-1144 | 1mg | 1115.00 | + Add to cart |
|
|
Product description
pTH (1-31) stimulates adenylyl cyclase in ROS 17/2 rat osteosarcoma cells as strongly as pTH (1-34) (teriparatide). However unlike pTH (1-34) it does not stimulate membrane-associated protein kinase C.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 157938-23-3 |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV |
Molecular Formula | C₁₆₂H₂₆₉N₄₉O₄₇S₂ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product